c ter Search Results


95
Chem Impex International di tert butyl dicarbonate
Di Tert Butyl Dicarbonate, supplied by Chem Impex International, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/c+ter/pm26676096-29-0-5?v=Chem+Impex+International
Average 95 stars, based on 1 article reviews
di tert butyl dicarbonate - by Bioz Stars, 2026-08
95/100 stars
  Buy from Supplier

95
Chem Impex International solution di tert butyl dicarbonate
Solution Di Tert Butyl Dicarbonate, supplied by Chem Impex International, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/c+ter/pm31059647__cb8b01083_si_001-373-2-5?v=Chem+Impex+International
Average 95 stars, based on 1 article reviews
solution di tert butyl dicarbonate - by Bioz Stars, 2026-08
95/100 stars
  Buy from Supplier

93
Boster Bio rabbit anti ccr8
Rabbit Anti Ccr8, supplied by Boster Bio, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/c+ter/pmc12002127-258-55-58?v=Boster+Bio
Average 93 stars, based on 1 article reviews
rabbit anti ccr8 - by Bioz Stars, 2026-08
93/100 stars
  Buy from Supplier

90
DuPont de Nemours antiserum anti-c-myc n-ter ii
Antiserum Anti C Myc N Ter Ii, supplied by DuPont de Nemours, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/c+ter/10__1128_slash_mcb__6__3__942-188-1-28?v=DuPont+de+Nemours
Average 90 stars, based on 1 article reviews
antiserum anti-c-myc n-ter ii - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
ProteoGenix n-terminal 5-tamra (5-carboxytetramethylrhodamine) label
N Terminal 5 Tamra (5 Carboxytetramethylrhodamine) Label, supplied by ProteoGenix, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/c+ter/pmc06340113-67-4-9?v=ProteoGenix
Average 90 stars, based on 1 article reviews
n-terminal 5-tamra (5-carboxytetramethylrhodamine) label - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
Verlag GmbH ter ms and c onditions
Ter Ms And C Onditions, supplied by Verlag GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/c+ter/pm29210481-252-6-42?v=Verlag+GmbH
Average 90 stars, based on 1 article reviews
ter ms and c onditions - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
GenScript corporation peptidisc nsp r (amino acids sequence: n ter -faekfkeavkdyfakfwdpaaeklkeavkdyfaklwd-c ter)
Expression, purification and reconstitution of MmpL3 Msm into peptidiscs for cryo-EM investigation A- Purification steps of MmpL3 Msm on Coomassie-stained SDS-PAGE. The shift of the protein molecular weight from ∼110 kDa to ∼85 kDa corresponds to TEV cleavage. CE, crude extract: sample after bacterial lysis obtained by sonication; SF, soluble fraction: lysed fraction after centrifugation, containing soluble proteins; CM, crude membranes: supernatant after ultracentrifugation 1 and 2; IM, insoluble membranes: resuspended pellet after ultracentrifugation 1 and 2; SM, soluble membranes: supernatant from ultracentrifugation 3, containing insoluble membranes in solution after addition of 1 % (w/v) DDM; FT, flow-through; W, wash; E, elution; NO TEV: same sample as the elution fraction (E) of IMAC 1; TEV: sample dialyzed overnight in the presence of TEV protease. B- Elution profile of MmpL3 Msm <t>:peptidisc</t> on size-exclusion chromatography. 1 mg of protein was incubated with the NSPr peptides at a molar ratio of 1:20. Solution was diluted to a final volume of 1 mL in buffer H and loaded on a Superdex 200 Increase 10/300 GL column and eluted in the same buffer at a flow rate of 0.35 mL min −1 on an ÄKTA pure 25 M at 4 °C. Fractions of 0.5 mL were collected. The first peak corresponds to MmpL3 Msm :peptidisc while the second corresponds to peptidiscs in excess. Fractions between the two dash lines were analyzed by Coomassie-stained SDS-PAGE. The rightmost sample corresponds to peptidisc alone, as a control. C- Representative micrograph of 3 μL of sample concentrated at 3 mg mL −1 and frozen on a holey carbon grid (Quantifoil Cu R1.2/1.3, 300 mesh).
Peptidisc Nsp R (Amino Acids Sequence: N Ter Faekfkeavkdyfakfwdpaaeklkeavkdyfaklwd C Ter), supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/c+ter/pmc10682824-117-0-14?v=GenScript+corporation
Average 90 stars, based on 1 article reviews
peptidisc nsp r (amino acids sequence: n ter -faekfkeavkdyfakfwdpaaeklkeavkdyfaklwd-c ter) - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
ProteoGenix tamra -c-ter bdnf
Expression, purification and reconstitution of MmpL3 Msm into peptidiscs for cryo-EM investigation A- Purification steps of MmpL3 Msm on Coomassie-stained SDS-PAGE. The shift of the protein molecular weight from ∼110 kDa to ∼85 kDa corresponds to TEV cleavage. CE, crude extract: sample after bacterial lysis obtained by sonication; SF, soluble fraction: lysed fraction after centrifugation, containing soluble proteins; CM, crude membranes: supernatant after ultracentrifugation 1 and 2; IM, insoluble membranes: resuspended pellet after ultracentrifugation 1 and 2; SM, soluble membranes: supernatant from ultracentrifugation 3, containing insoluble membranes in solution after addition of 1 % (w/v) DDM; FT, flow-through; W, wash; E, elution; NO TEV: same sample as the elution fraction (E) of IMAC 1; TEV: sample dialyzed overnight in the presence of TEV protease. B- Elution profile of MmpL3 Msm <t>:peptidisc</t> on size-exclusion chromatography. 1 mg of protein was incubated with the NSPr peptides at a molar ratio of 1:20. Solution was diluted to a final volume of 1 mL in buffer H and loaded on a Superdex 200 Increase 10/300 GL column and eluted in the same buffer at a flow rate of 0.35 mL min −1 on an ÄKTA pure 25 M at 4 °C. Fractions of 0.5 mL were collected. The first peak corresponds to MmpL3 Msm :peptidisc while the second corresponds to peptidiscs in excess. Fractions between the two dash lines were analyzed by Coomassie-stained SDS-PAGE. The rightmost sample corresponds to peptidisc alone, as a control. C- Representative micrograph of 3 μL of sample concentrated at 3 mg mL −1 and frozen on a holey carbon grid (Quantifoil Cu R1.2/1.3, 300 mesh).
Tamra C Ter Bdnf, supplied by ProteoGenix, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/c+ter/bio_rxiv__2022__08__23__504973-173-12-18?v=ProteoGenix
Average 90 stars, based on 1 article reviews
tamra -c-ter bdnf - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
GeneTex anti-myosin 18b c-ter gtx104872
Expression, purification and reconstitution of MmpL3 Msm into peptidiscs for cryo-EM investigation A- Purification steps of MmpL3 Msm on Coomassie-stained SDS-PAGE. The shift of the protein molecular weight from ∼110 kDa to ∼85 kDa corresponds to TEV cleavage. CE, crude extract: sample after bacterial lysis obtained by sonication; SF, soluble fraction: lysed fraction after centrifugation, containing soluble proteins; CM, crude membranes: supernatant after ultracentrifugation 1 and 2; IM, insoluble membranes: resuspended pellet after ultracentrifugation 1 and 2; SM, soluble membranes: supernatant from ultracentrifugation 3, containing insoluble membranes in solution after addition of 1 % (w/v) DDM; FT, flow-through; W, wash; E, elution; NO TEV: same sample as the elution fraction (E) of IMAC 1; TEV: sample dialyzed overnight in the presence of TEV protease. B- Elution profile of MmpL3 Msm <t>:peptidisc</t> on size-exclusion chromatography. 1 mg of protein was incubated with the NSPr peptides at a molar ratio of 1:20. Solution was diluted to a final volume of 1 mL in buffer H and loaded on a Superdex 200 Increase 10/300 GL column and eluted in the same buffer at a flow rate of 0.35 mL min −1 on an ÄKTA pure 25 M at 4 °C. Fractions of 0.5 mL were collected. The first peak corresponds to MmpL3 Msm :peptidisc while the second corresponds to peptidiscs in excess. Fractions between the two dash lines were analyzed by Coomassie-stained SDS-PAGE. The rightmost sample corresponds to peptidisc alone, as a control. C- Representative micrograph of 3 μL of sample concentrated at 3 mg mL −1 and frozen on a holey carbon grid (Quantifoil Cu R1.2/1.3, 300 mesh).
Anti Myosin 18b C Ter Gtx104872, supplied by GeneTex, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/c+ter/10__3233_slash_jnd___150085-51-8-12?v=GeneTex
Average 90 stars, based on 1 article reviews
anti-myosin 18b c-ter gtx104872 - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
Merck KGaA pdest42-ctdnep1_c-ter plasmid
Expression, purification and reconstitution of MmpL3 Msm into peptidiscs for cryo-EM investigation A- Purification steps of MmpL3 Msm on Coomassie-stained SDS-PAGE. The shift of the protein molecular weight from ∼110 kDa to ∼85 kDa corresponds to TEV cleavage. CE, crude extract: sample after bacterial lysis obtained by sonication; SF, soluble fraction: lysed fraction after centrifugation, containing soluble proteins; CM, crude membranes: supernatant after ultracentrifugation 1 and 2; IM, insoluble membranes: resuspended pellet after ultracentrifugation 1 and 2; SM, soluble membranes: supernatant from ultracentrifugation 3, containing insoluble membranes in solution after addition of 1 % (w/v) DDM; FT, flow-through; W, wash; E, elution; NO TEV: same sample as the elution fraction (E) of IMAC 1; TEV: sample dialyzed overnight in the presence of TEV protease. B- Elution profile of MmpL3 Msm <t>:peptidisc</t> on size-exclusion chromatography. 1 mg of protein was incubated with the NSPr peptides at a molar ratio of 1:20. Solution was diluted to a final volume of 1 mL in buffer H and loaded on a Superdex 200 Increase 10/300 GL column and eluted in the same buffer at a flow rate of 0.35 mL min −1 on an ÄKTA pure 25 M at 4 °C. Fractions of 0.5 mL were collected. The first peak corresponds to MmpL3 Msm :peptidisc while the second corresponds to peptidiscs in excess. Fractions between the two dash lines were analyzed by Coomassie-stained SDS-PAGE. The rightmost sample corresponds to peptidisc alone, as a control. C- Representative micrograph of 3 μL of sample concentrated at 3 mg mL −1 and frozen on a holey carbon grid (Quantifoil Cu R1.2/1.3, 300 mesh).
Pdest42 Ctdnep1 C Ter Plasmid, supplied by Merck KGaA, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/c+ter/pmc08043254-345-4-14?v=Merck+KGaA
Average 90 stars, based on 1 article reviews
pdest42-ctdnep1_c-ter plasmid - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
DuPont de Nemours anti-c-myc n-ter ii
Expression, purification and reconstitution of MmpL3 Msm into peptidiscs for cryo-EM investigation A- Purification steps of MmpL3 Msm on Coomassie-stained SDS-PAGE. The shift of the protein molecular weight from ∼110 kDa to ∼85 kDa corresponds to TEV cleavage. CE, crude extract: sample after bacterial lysis obtained by sonication; SF, soluble fraction: lysed fraction after centrifugation, containing soluble proteins; CM, crude membranes: supernatant after ultracentrifugation 1 and 2; IM, insoluble membranes: resuspended pellet after ultracentrifugation 1 and 2; SM, soluble membranes: supernatant from ultracentrifugation 3, containing insoluble membranes in solution after addition of 1 % (w/v) DDM; FT, flow-through; W, wash; E, elution; NO TEV: same sample as the elution fraction (E) of IMAC 1; TEV: sample dialyzed overnight in the presence of TEV protease. B- Elution profile of MmpL3 Msm <t>:peptidisc</t> on size-exclusion chromatography. 1 mg of protein was incubated with the NSPr peptides at a molar ratio of 1:20. Solution was diluted to a final volume of 1 mL in buffer H and loaded on a Superdex 200 Increase 10/300 GL column and eluted in the same buffer at a flow rate of 0.35 mL min −1 on an ÄKTA pure 25 M at 4 °C. Fractions of 0.5 mL were collected. The first peak corresponds to MmpL3 Msm :peptidisc while the second corresponds to peptidiscs in excess. Fractions between the two dash lines were analyzed by Coomassie-stained SDS-PAGE. The rightmost sample corresponds to peptidisc alone, as a control. C- Representative micrograph of 3 μL of sample concentrated at 3 mg mL −1 and frozen on a holey carbon grid (Quantifoil Cu R1.2/1.3, 300 mesh).
Anti C Myc N Ter Ii, supplied by DuPont de Nemours, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/c+ter/10__1128_slash_mcb__6__3__942-38-3-28?v=DuPont+de+Nemours
Average 90 stars, based on 1 article reviews
anti-c-myc n-ter ii - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

90
Informa UK Limited in ter fa c e 2022
Expression, purification and reconstitution of MmpL3 Msm into peptidiscs for cryo-EM investigation A- Purification steps of MmpL3 Msm on Coomassie-stained SDS-PAGE. The shift of the protein molecular weight from ∼110 kDa to ∼85 kDa corresponds to TEV cleavage. CE, crude extract: sample after bacterial lysis obtained by sonication; SF, soluble fraction: lysed fraction after centrifugation, containing soluble proteins; CM, crude membranes: supernatant after ultracentrifugation 1 and 2; IM, insoluble membranes: resuspended pellet after ultracentrifugation 1 and 2; SM, soluble membranes: supernatant from ultracentrifugation 3, containing insoluble membranes in solution after addition of 1 % (w/v) DDM; FT, flow-through; W, wash; E, elution; NO TEV: same sample as the elution fraction (E) of IMAC 1; TEV: sample dialyzed overnight in the presence of TEV protease. B- Elution profile of MmpL3 Msm <t>:peptidisc</t> on size-exclusion chromatography. 1 mg of protein was incubated with the NSPr peptides at a molar ratio of 1:20. Solution was diluted to a final volume of 1 mL in buffer H and loaded on a Superdex 200 Increase 10/300 GL column and eluted in the same buffer at a flow rate of 0.35 mL min −1 on an ÄKTA pure 25 M at 4 °C. Fractions of 0.5 mL were collected. The first peak corresponds to MmpL3 Msm :peptidisc while the second corresponds to peptidiscs in excess. Fractions between the two dash lines were analyzed by Coomassie-stained SDS-PAGE. The rightmost sample corresponds to peptidisc alone, as a control. C- Representative micrograph of 3 μL of sample concentrated at 3 mg mL −1 and frozen on a holey carbon grid (Quantifoil Cu R1.2/1.3, 300 mesh).
In Ter Fa C E 2022, supplied by Informa UK Limited, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/c+ter/10__1080_slash_14649357__2022__2113613-11-0-8?v=Informa+UK+Limited
Average 90 stars, based on 1 article reviews
in ter fa c e 2022 - by Bioz Stars, 2026-08
90/100 stars
  Buy from Supplier

Image Search Results


Expression, purification and reconstitution of MmpL3 Msm into peptidiscs for cryo-EM investigation A- Purification steps of MmpL3 Msm on Coomassie-stained SDS-PAGE. The shift of the protein molecular weight from ∼110 kDa to ∼85 kDa corresponds to TEV cleavage. CE, crude extract: sample after bacterial lysis obtained by sonication; SF, soluble fraction: lysed fraction after centrifugation, containing soluble proteins; CM, crude membranes: supernatant after ultracentrifugation 1 and 2; IM, insoluble membranes: resuspended pellet after ultracentrifugation 1 and 2; SM, soluble membranes: supernatant from ultracentrifugation 3, containing insoluble membranes in solution after addition of 1 % (w/v) DDM; FT, flow-through; W, wash; E, elution; NO TEV: same sample as the elution fraction (E) of IMAC 1; TEV: sample dialyzed overnight in the presence of TEV protease. B- Elution profile of MmpL3 Msm :peptidisc on size-exclusion chromatography. 1 mg of protein was incubated with the NSPr peptides at a molar ratio of 1:20. Solution was diluted to a final volume of 1 mL in buffer H and loaded on a Superdex 200 Increase 10/300 GL column and eluted in the same buffer at a flow rate of 0.35 mL min −1 on an ÄKTA pure 25 M at 4 °C. Fractions of 0.5 mL were collected. The first peak corresponds to MmpL3 Msm :peptidisc while the second corresponds to peptidiscs in excess. Fractions between the two dash lines were analyzed by Coomassie-stained SDS-PAGE. The rightmost sample corresponds to peptidisc alone, as a control. C- Representative micrograph of 3 μL of sample concentrated at 3 mg mL −1 and frozen on a holey carbon grid (Quantifoil Cu R1.2/1.3, 300 mesh).

Journal: Current Research in Structural Biology

Article Title: Cryo-EM structure of the trehalose monomycolate transporter, MmpL3, reconstituted into peptidiscs

doi: 10.1016/j.crstbi.2023.100109

Figure Lengend Snippet: Expression, purification and reconstitution of MmpL3 Msm into peptidiscs for cryo-EM investigation A- Purification steps of MmpL3 Msm on Coomassie-stained SDS-PAGE. The shift of the protein molecular weight from ∼110 kDa to ∼85 kDa corresponds to TEV cleavage. CE, crude extract: sample after bacterial lysis obtained by sonication; SF, soluble fraction: lysed fraction after centrifugation, containing soluble proteins; CM, crude membranes: supernatant after ultracentrifugation 1 and 2; IM, insoluble membranes: resuspended pellet after ultracentrifugation 1 and 2; SM, soluble membranes: supernatant from ultracentrifugation 3, containing insoluble membranes in solution after addition of 1 % (w/v) DDM; FT, flow-through; W, wash; E, elution; NO TEV: same sample as the elution fraction (E) of IMAC 1; TEV: sample dialyzed overnight in the presence of TEV protease. B- Elution profile of MmpL3 Msm :peptidisc on size-exclusion chromatography. 1 mg of protein was incubated with the NSPr peptides at a molar ratio of 1:20. Solution was diluted to a final volume of 1 mL in buffer H and loaded on a Superdex 200 Increase 10/300 GL column and eluted in the same buffer at a flow rate of 0.35 mL min −1 on an ÄKTA pure 25 M at 4 °C. Fractions of 0.5 mL were collected. The first peak corresponds to MmpL3 Msm :peptidisc while the second corresponds to peptidiscs in excess. Fractions between the two dash lines were analyzed by Coomassie-stained SDS-PAGE. The rightmost sample corresponds to peptidisc alone, as a control. C- Representative micrograph of 3 μL of sample concentrated at 3 mg mL −1 and frozen on a holey carbon grid (Quantifoil Cu R1.2/1.3, 300 mesh).

Article Snippet: Peptidisc NSP r (amino acids sequence: N ter -FAEKFKEAVKDYFAKFWDPAAEKLKEAVKDYFAKLWD-C ter ) was obtained from Genscript with a minimum purity of 80 %.

Techniques: Expressing, Purification, Cryo-EM Sample Prep, Staining, SDS Page, Molecular Weight, Lysis, Sonication, Centrifugation, Size-exclusion Chromatography, Incubation, Control

Data processing, refinement and model statistics.

Journal: Current Research in Structural Biology

Article Title: Cryo-EM structure of the trehalose monomycolate transporter, MmpL3, reconstituted into peptidiscs

doi: 10.1016/j.crstbi.2023.100109

Figure Lengend Snippet: Data processing, refinement and model statistics.

Article Snippet: Peptidisc NSP r (amino acids sequence: N ter -FAEKFKEAVKDYFAKFWDPAAEKLKEAVKDYFAKLWD-C ter ) was obtained from Genscript with a minimum purity of 80 %.

Techniques: Software, Biomarker Discovery

Cryo-EM maps quality and model building A- The local resolution map ranging from 3 to 5 Å resolution was calculated with cryoSPARC. The map attests that the highest resolution (dark blue) correlates with the transmembrane helices. The map contour (level 0.21 in ChimeraX) was adjusted so that the peptidisc peptides are not visible. B- The map at 3.2 Å (Map 2) resolution is represented as a white transparent surface. The MmpL3 Msm model fitted in the map is represented as a cartoon and colored according to the different domains. PD1 and PD2 stand for periplasmic domains 1 and 2. MMPL domain 1 encompasses the transmembrane helices 1 to 6 while MMPL domain 2 is composed of helices 7 to 12. The linker region separates the two MMPL domains. The map contour is 0.33 and displayed in ChimeraX. C- Representation of the EM map. The 3.2 Å resolution map (Map 2) is shown as a blue mesh and contoured (level 5 σ in PyMOL) around each transmembrane helix (TM) and represented as sticks. D- EM map (Map 1, level 0.12 in ChimeraX) attesting the presence of peptides from the peptidisc. The helical peptides surrounding MmpL3 Msm are shown as red cartoons while the corresponding EM map is depicted as a yellow transparent surface. Almost all the TM parts of MmpL3 Msm are embedded into peptidiscs apart from the linker region. (For interpretation of the references to color in this figure legend, the reader is referred to the Web version of this article.)

Journal: Current Research in Structural Biology

Article Title: Cryo-EM structure of the trehalose monomycolate transporter, MmpL3, reconstituted into peptidiscs

doi: 10.1016/j.crstbi.2023.100109

Figure Lengend Snippet: Cryo-EM maps quality and model building A- The local resolution map ranging from 3 to 5 Å resolution was calculated with cryoSPARC. The map attests that the highest resolution (dark blue) correlates with the transmembrane helices. The map contour (level 0.21 in ChimeraX) was adjusted so that the peptidisc peptides are not visible. B- The map at 3.2 Å (Map 2) resolution is represented as a white transparent surface. The MmpL3 Msm model fitted in the map is represented as a cartoon and colored according to the different domains. PD1 and PD2 stand for periplasmic domains 1 and 2. MMPL domain 1 encompasses the transmembrane helices 1 to 6 while MMPL domain 2 is composed of helices 7 to 12. The linker region separates the two MMPL domains. The map contour is 0.33 and displayed in ChimeraX. C- Representation of the EM map. The 3.2 Å resolution map (Map 2) is shown as a blue mesh and contoured (level 5 σ in PyMOL) around each transmembrane helix (TM) and represented as sticks. D- EM map (Map 1, level 0.12 in ChimeraX) attesting the presence of peptides from the peptidisc. The helical peptides surrounding MmpL3 Msm are shown as red cartoons while the corresponding EM map is depicted as a yellow transparent surface. Almost all the TM parts of MmpL3 Msm are embedded into peptidiscs apart from the linker region. (For interpretation of the references to color in this figure legend, the reader is referred to the Web version of this article.)

Article Snippet: Peptidisc NSP r (amino acids sequence: N ter -FAEKFKEAVKDYFAKFWDPAAEKLKEAVKDYFAKLWD-C ter ) was obtained from Genscript with a minimum purity of 80 %.

Techniques: Cryo-EM Sample Prep