c ter Search Results


95
Chem Impex International di tert butyl dicarbonate
Di Tert Butyl Dicarbonate, supplied by Chem Impex International, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/di tert butyl dicarbonate/product/Chem Impex International
Average 95 stars, based on 1 article reviews
di tert butyl dicarbonate - by Bioz Stars, 2026-06
95/100 stars
  Buy from Supplier

95
Chem Impex International solution di tert butyl dicarbonate
Solution Di Tert Butyl Dicarbonate, supplied by Chem Impex International, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/solution di tert butyl dicarbonate/product/Chem Impex International
Average 95 stars, based on 1 article reviews
solution di tert butyl dicarbonate - by Bioz Stars, 2026-06
95/100 stars
  Buy from Supplier

93
Boster Bio rabbit anti ccr8
Rabbit Anti Ccr8, supplied by Boster Bio, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/rabbit anti ccr8/product/Boster Bio
Average 93 stars, based on 1 article reviews
rabbit anti ccr8 - by Bioz Stars, 2026-06
93/100 stars
  Buy from Supplier

90
ProteoGenix tamra -c-ter bdnf
Tamra C Ter Bdnf, supplied by ProteoGenix, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/tamra -c-ter bdnf/product/ProteoGenix
Average 90 stars, based on 1 article reviews
tamra -c-ter bdnf - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
Verlag GmbH ter ms and c onditions
Ter Ms And C Onditions, supplied by Verlag GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/ter ms and c onditions/product/Verlag GmbH
Average 90 stars, based on 1 article reviews
ter ms and c onditions - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
DuPont de Nemours antiserum anti-c-myc n-ter ii
Antiserum Anti C Myc N Ter Ii, supplied by DuPont de Nemours, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/antiserum anti-c-myc n-ter ii/product/DuPont de Nemours
Average 90 stars, based on 1 article reviews
antiserum anti-c-myc n-ter ii - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
ProteoGenix n-terminal 5-tamra (5-carboxytetramethylrhodamine) label
N Terminal 5 Tamra (5 Carboxytetramethylrhodamine) Label, supplied by ProteoGenix, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/n-terminal 5-tamra (5-carboxytetramethylrhodamine) label/product/ProteoGenix
Average 90 stars, based on 1 article reviews
n-terminal 5-tamra (5-carboxytetramethylrhodamine) label - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
GenScript corporation peptide nsp (n ter - dwlkafydkvaeklkeaapdwfkafydkvaekfkeaf-c ter)
Peptide Nsp (N Ter Dwlkafydkvaeklkeaapdwfkafydkvaekfkeaf C Ter), supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/peptide nsp (n ter - dwlkafydkvaeklkeaapdwfkafydkvaekfkeaf-c ter)/product/GenScript corporation
Average 90 stars, based on 1 article reviews
peptide nsp (n ter - dwlkafydkvaeklkeaapdwfkafydkvaekfkeaf-c ter) - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
Informa UK Limited in ter fa c e 2022
In Ter Fa C E 2022, supplied by Informa UK Limited, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/in ter fa c e 2022/product/Informa UK Limited
Average 90 stars, based on 1 article reviews
in ter fa c e 2022 - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
CST Berger ter ms and c onditions
Ter Ms And C Onditions, supplied by CST Berger, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/ter ms and c onditions/product/CST Berger
Average 90 stars, based on 1 article reviews
ter ms and c onditions - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
Auspep Pty human c-ter anking peptide of gastrin (ctfp)
Human C Ter Anking Peptide Of Gastrin (Ctfp), supplied by Auspep Pty, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/human c-ter anking peptide of gastrin (ctfp)/product/Auspep Pty
Average 90 stars, based on 1 article reviews
human c-ter anking peptide of gastrin (ctfp) - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

90
GeneTex anti-myosin 18b c-ter gtx104872
Anti Myosin 18b C Ter Gtx104872, supplied by GeneTex, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/result/anti-myosin 18b c-ter gtx104872/product/GeneTex
Average 90 stars, based on 1 article reviews
anti-myosin 18b c-ter gtx104872 - by Bioz Stars, 2026-06
90/100 stars
  Buy from Supplier

Image Search Results