|
Chem Impex International
di tert butyl dicarbonate Di Tert Butyl Dicarbonate, supplied by Chem Impex International, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/c+ter/pm26676096-29-0-5?v=Chem+Impex+International Average 95 stars, based on 1 article reviews
di tert butyl dicarbonate - by Bioz Stars,
2026-08
95/100 stars
|
Buy from Supplier |
|
Chem Impex International
solution di tert butyl dicarbonate Solution Di Tert Butyl Dicarbonate, supplied by Chem Impex International, used in various techniques. Bioz Stars score: 95/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/c+ter/pm31059647__cb8b01083_si_001-373-2-5?v=Chem+Impex+International Average 95 stars, based on 1 article reviews
solution di tert butyl dicarbonate - by Bioz Stars,
2026-08
95/100 stars
|
Buy from Supplier |
|
Boster Bio
rabbit anti ccr8 Rabbit Anti Ccr8, supplied by Boster Bio, used in various techniques. Bioz Stars score: 93/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/c+ter/pmc12002127-258-55-58?v=Boster+Bio Average 93 stars, based on 1 article reviews
rabbit anti ccr8 - by Bioz Stars,
2026-08
93/100 stars
|
Buy from Supplier |
|
DuPont de Nemours
antiserum anti-c-myc n-ter ii Antiserum Anti C Myc N Ter Ii, supplied by DuPont de Nemours, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/c+ter/10__1128_slash_mcb__6__3__942-188-1-28?v=DuPont+de+Nemours Average 90 stars, based on 1 article reviews
antiserum anti-c-myc n-ter ii - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
ProteoGenix
n-terminal 5-tamra (5-carboxytetramethylrhodamine) label N Terminal 5 Tamra (5 Carboxytetramethylrhodamine) Label, supplied by ProteoGenix, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/c+ter/pmc06340113-67-4-9?v=ProteoGenix Average 90 stars, based on 1 article reviews
n-terminal 5-tamra (5-carboxytetramethylrhodamine) label - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
Verlag GmbH
ter ms and c onditions Ter Ms And C Onditions, supplied by Verlag GmbH, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/c+ter/pm29210481-252-6-42?v=Verlag+GmbH Average 90 stars, based on 1 article reviews
ter ms and c onditions - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
GenScript corporation
peptidisc nsp r (amino acids sequence: n ter -faekfkeavkdyfakfwdpaaeklkeavkdyfaklwd-c ter) ![]() Peptidisc Nsp R (Amino Acids Sequence: N Ter Faekfkeavkdyfakfwdpaaeklkeavkdyfaklwd C Ter), supplied by GenScript corporation, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/c+ter/pmc10682824-117-0-14?v=GenScript+corporation Average 90 stars, based on 1 article reviews
peptidisc nsp r (amino acids sequence: n ter -faekfkeavkdyfakfwdpaaeklkeavkdyfaklwd-c ter) - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
ProteoGenix
tamra -c-ter bdnf ![]() Tamra C Ter Bdnf, supplied by ProteoGenix, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/c+ter/bio_rxiv__2022__08__23__504973-173-12-18?v=ProteoGenix Average 90 stars, based on 1 article reviews
tamra -c-ter bdnf - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
GeneTex
anti-myosin 18b c-ter gtx104872 ![]() Anti Myosin 18b C Ter Gtx104872, supplied by GeneTex, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/c+ter/10__3233_slash_jnd___150085-51-8-12?v=GeneTex Average 90 stars, based on 1 article reviews
anti-myosin 18b c-ter gtx104872 - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
Merck KGaA
pdest42-ctdnep1_c-ter plasmid ![]() Pdest42 Ctdnep1 C Ter Plasmid, supplied by Merck KGaA, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/c+ter/pmc08043254-345-4-14?v=Merck+KGaA Average 90 stars, based on 1 article reviews
pdest42-ctdnep1_c-ter plasmid - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
DuPont de Nemours
anti-c-myc n-ter ii ![]() Anti C Myc N Ter Ii, supplied by DuPont de Nemours, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/c+ter/10__1128_slash_mcb__6__3__942-38-3-28?v=DuPont+de+Nemours Average 90 stars, based on 1 article reviews
anti-c-myc n-ter ii - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
|
Informa UK Limited
in ter fa c e 2022 ![]() In Ter Fa C E 2022, supplied by Informa UK Limited, used in various techniques. Bioz Stars score: 90/100, based on 1 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more https://www.bioz.com/product/c+ter/10__1080_slash_14649357__2022__2113613-11-0-8?v=Informa+UK+Limited Average 90 stars, based on 1 article reviews
in ter fa c e 2022 - by Bioz Stars,
2026-08
90/100 stars
|
Buy from Supplier |
Image Search Results
Journal: Current Research in Structural Biology
Article Title: Cryo-EM structure of the trehalose monomycolate transporter, MmpL3, reconstituted into peptidiscs
doi: 10.1016/j.crstbi.2023.100109
Figure Lengend Snippet: Expression, purification and reconstitution of MmpL3 Msm into peptidiscs for cryo-EM investigation A- Purification steps of MmpL3 Msm on Coomassie-stained SDS-PAGE. The shift of the protein molecular weight from ∼110 kDa to ∼85 kDa corresponds to TEV cleavage. CE, crude extract: sample after bacterial lysis obtained by sonication; SF, soluble fraction: lysed fraction after centrifugation, containing soluble proteins; CM, crude membranes: supernatant after ultracentrifugation 1 and 2; IM, insoluble membranes: resuspended pellet after ultracentrifugation 1 and 2; SM, soluble membranes: supernatant from ultracentrifugation 3, containing insoluble membranes in solution after addition of 1 % (w/v) DDM; FT, flow-through; W, wash; E, elution; NO TEV: same sample as the elution fraction (E) of IMAC 1; TEV: sample dialyzed overnight in the presence of TEV protease. B- Elution profile of MmpL3 Msm :peptidisc on size-exclusion chromatography. 1 mg of protein was incubated with the NSPr peptides at a molar ratio of 1:20. Solution was diluted to a final volume of 1 mL in buffer H and loaded on a Superdex 200 Increase 10/300 GL column and eluted in the same buffer at a flow rate of 0.35 mL min −1 on an ÄKTA pure 25 M at 4 °C. Fractions of 0.5 mL were collected. The first peak corresponds to MmpL3 Msm :peptidisc while the second corresponds to peptidiscs in excess. Fractions between the two dash lines were analyzed by Coomassie-stained SDS-PAGE. The rightmost sample corresponds to peptidisc alone, as a control. C- Representative micrograph of 3 μL of sample concentrated at 3 mg mL −1 and frozen on a holey carbon grid (Quantifoil Cu R1.2/1.3, 300 mesh).
Article Snippet:
Techniques: Expressing, Purification, Cryo-EM Sample Prep, Staining, SDS Page, Molecular Weight, Lysis, Sonication, Centrifugation, Size-exclusion Chromatography, Incubation, Control
Journal: Current Research in Structural Biology
Article Title: Cryo-EM structure of the trehalose monomycolate transporter, MmpL3, reconstituted into peptidiscs
doi: 10.1016/j.crstbi.2023.100109
Figure Lengend Snippet: Data processing, refinement and model statistics.
Article Snippet:
Techniques: Software, Biomarker Discovery
Journal: Current Research in Structural Biology
Article Title: Cryo-EM structure of the trehalose monomycolate transporter, MmpL3, reconstituted into peptidiscs
doi: 10.1016/j.crstbi.2023.100109
Figure Lengend Snippet: Cryo-EM maps quality and model building A- The local resolution map ranging from 3 to 5 Å resolution was calculated with cryoSPARC. The map attests that the highest resolution (dark blue) correlates with the transmembrane helices. The map contour (level 0.21 in ChimeraX) was adjusted so that the peptidisc peptides are not visible. B- The map at 3.2 Å (Map 2) resolution is represented as a white transparent surface. The MmpL3 Msm model fitted in the map is represented as a cartoon and colored according to the different domains. PD1 and PD2 stand for periplasmic domains 1 and 2. MMPL domain 1 encompasses the transmembrane helices 1 to 6 while MMPL domain 2 is composed of helices 7 to 12. The linker region separates the two MMPL domains. The map contour is 0.33 and displayed in ChimeraX. C- Representation of the EM map. The 3.2 Å resolution map (Map 2) is shown as a blue mesh and contoured (level 5 σ in PyMOL) around each transmembrane helix (TM) and represented as sticks. D- EM map (Map 1, level 0.12 in ChimeraX) attesting the presence of peptides from the peptidisc. The helical peptides surrounding MmpL3 Msm are shown as red cartoons while the corresponding EM map is depicted as a yellow transparent surface. Almost all the TM parts of MmpL3 Msm are embedded into peptidiscs apart from the linker region. (For interpretation of the references to color in this figure legend, the reader is referred to the Web version of this article.)
Article Snippet:
Techniques: Cryo-EM Sample Prep